Вакцина «ЭпиВакКорона» в иллюстрациях

Ольга Матвеева

Ниже представлена полная версия статьи. В .pdf и бумажной версии опубликована сокращенная версия статьи.

О российской вакцине, получившей название , известно пока немного. Ее разработка характеризуется большой непрозрачностью; этому была посвящена моя статья в ТрВ-Наука [1]. В то же время вакцина была запатентована, и поэтому источником информации о разработке может служить опубликованный патент [2]. В данной статье, отчасти в виде графики, рассказывается о том, как устроена вакцина и как она испытывалась на животных.

Состав

Согласно разработчикам, «вакцина представляет собой химически синтезированные пептидные антигены трех фрагментов S-белка а SARS-CoV-2, конъюгированные с белком-носителем и адсорбированные на алюминий-содержащем адъюванте» [2, 3]. S- — это шиповидный белок вируса, он же спайк (spike-protein; в разных текстах его называют по-разному). Пептид — это фрагмент белка. В патенте описано три пептида шиповидного белка, которые используются при создании вакцины.

В качестве носителя в вакцинной разработке применяется вирусный нуклеокапсидный белок — продукт экспрессии гена в кишечной палочке: он производится в бактерии в виде химеры с еще одним белком именно бактериального происхождения. Небольшой фрагмент белка, который называется гис-таг, используется для очистки химерного белка из лизата кишечной палочки [2, 4]. Рис. 1 схематически изображает состав и методы производства иммуногенов «ЭпиВакКороны».

Слева на рис. 1 изображен SARS-CoV-2 и стрелочками отмечены два вирусных белка, а именно шиповидный, который обозначен красном сердечком снаружи вируса, и нуклеокапсидный, который обозначен синим кружочком внутри вируса. Для того, чтобы иммунная система человека научилась распознавать шиповидный белок вируса, в состав «ЭпиВакКороны» вводятся три фрагмента этого белка, которые разработчики химически синтезируют. Этот процесс обозначен как «химический синтез» на правой части рисунка. Каждый белковый фрагмент (пептид) представлен последовательностью аминокислот, обозначенными белыми буквами на красных полосках в правой части рисунка.

Для ознакомления иммунной системы человека с нуклеокапсидным вирусным белком разработчики сделали специальный генетический конструкт, который позволил им производить белок в кишечной палочке. Они соединили ген, кодирующий этот вирусный белок с бактериальным геном, кодирующим белок способный связывать сахар мальтозу. В результате кишечная палочка приобрела способность производить химерный белок.

На правой части рисунка он показан как большой синий круг с присоединенным снизу коричневым полукругом. Так же, как и гис-таг, белок нужен для очистки химерного белка после его производства в кишечной палочке. После очистки химерный белок с помощью процесса химической коньюгации соединяют с тремя пептидами шиповидного белка. К каждой молекуле химерного белка присоединяется только один тип молекул пептида. Таким образом, мы имеем в конечном варианте три типа молекул, а именно химерный белок, коньюгированный с пептидом номер 1, с пептидом номер 2 и с пептидом номер 3. Все три типа молекул вместе с алюминий-содержащем адьювантом используют в качестве вакцинного материала.

Рис. 1. Антигены коронавируса и кишечной палочки для «ЭпиВакКороны»
Рис. 1. Антигены коронавируса и кишечной палочки для «ЭпиВакКороны»

 

Схема, изображенная на рис. 1, позволяет понять, что чужеродными антигенами в вакцине могут служить не только три пептида шиповидного белка, но и вирусный нуклеокапсидный белок; бактериальный белок, связывающий сахар мальтозу; и даже, возможно, гис-таг, о котором шла речь выше. Поэтому у вакцинированного человека могут формироваться антитела не только на шиповидного белка, но и на другие антигены, присутствующие в вакцине.

К сожалению, ничего не известно о детекционной системе «Вектора», которую разработчики «ЭпиВакКороны» рекомендуют для обнаружения антител у вакцинированных. Детектирует ли эта система только антитела к пептидам шиповидного белка, которые теоретически могут быть протективными? Может быть, она также способна детектировать антитела к другим белкам, которые входят в состав вакцины, но не способны провоцировать образование протективных антител? К последним относится, например, химерный белок, составленный из вирусного нуклеокапсидного и бактериального мальтозасвязывающего.

SARS-CoV-2 устроен так, что нейтрализовать его могут только антитела к шиповидному белку. Антитела к нуклеокапсидному белку этого сделать не могут: этот белок находится внутри вирусной частицы, и антитела не могут с ним провзаимодействовать, следовательно, он недоступен для антител в интактном вирусе. (Об этой особенности устройства вируса я уже писала [1].) Антитела к фрагменту белка из бактерии тем более не способны защитить человека от вирусной инфекции. Детектирует ли система антитела к пептиду гис-таг? На этот фрагмент белка тоже могут образоваться антитела без защитной противовирусной функции.

Пептиды (фрагменты белка)

По замыслу разработчиков пептиды «ЭпиВакКороны» содержат В-клеточные эпитопы [2]. Прежде всего, стоит снова объяснить, что эпитоп (он же антигенная детерминанта) — это часть макромолекулы (в нашем случае — вирусного белка или белка из вакцинного материала), которая распознается иммунными клетками. Как должны работать пептиды? Специальные клетки организма — B-клетки — должны распознать эти пептиды и сформировать на них иммунный ответ в виде антител. При этом последние смогут сыграть защитную роль только в том случае, если они способны узнать те же пептиды в трехмерной структуре шиповидного белка в природе и физически с ними провзаимодействовать.

Далеко не каждый пептид шиповидного белка может сыграть такую роль, а именно спровоцировать производство антител у человека, которые бы узнавали этот же пептид и могли бы присоединиться к нему в исходной трехмерной структуре белка. Трехмерная структура белка чисто физически закрывает большую часть его молекулы от взаимодействия с антителами. На поверхности молекулы вирусного белка оказывается очень мало коротких фрагментов (пептидов) с которыми могли бы связаться антитела. Кроме того, стоит заметить, что у вируса SARS-CoV-2, как и у многих других вирусов, есть способ защиты от антител — он заключается в использовании гликанового щита, т. е. молекул полисахаридов, присоединенных к шиповидному белку. Такое присоединение называется гликозилированием: антителам трудно подобраться к участкам белка с присоединенными полисахаридами — их просто не пускает гликановый щит [1].

Экспериментальным поиском таких пептидов занималось сразу несколько независимых лабораторий [5, 6, 7, 8]. Исследователи провели скрининговое картирование почти всех пептидных фрагментов шиповидного белка именно с целью поиска тех, которые видны иммунной системе людей и могут вызвать образование антител, в частности нейтрализующих.

Эксперимент построен так: на подложку последовательно, по принципу черепичной укладки, иммобилизуют пептиды шиповидного белка. Таких подложек готовится много. Потом на каждую подложку наливается плазма из крови выздоровевших больных. Далее, после образования комплекса пептид–антитело, происходит идентификация только тех пептидов, с которыми связались антитела. После первичного картирования и выявления пептидов шиповидного белка, которые узнаются антителами, следует вторая фаза исследования. В этой фазе ально устанавливают, на какие пептиды образуются именно нейтрализующие вирус антитела.

При таком систематическом скрининге было обнаружено лишь несколько белковых фрагментов, которые провоцируют у людей образование антител, и только некоторые из этих фрагментов могут провоцировать именно антитела, способные нейтрализовать вирус. Участки молекулы, идентифицированные в четырех упомянутых х, являются B-клеточными эпитопами. Они нанесены на карту аминокислотной последовательности шиповидного белка на рис. 2.

Рис. 2. Фрагменты S-белка, входящие в состав «ЭпиВакКороны», и линейные иммуногенные B-клеточные эпитопы, известные из литературы
Рис. 2. Фрагменты S-белка, входящие в состав «ЭпиВакКороны», и линейные иммуногенные B-клеточные эпитопы, известные из литературы

Увы, пептиды, найденные в независимых лабораториях, часто совпадают друг с другом, но не совпадают с пептидами, которые использует «Вектор» в вакцинной разработке. Разработчики вакцины заявляют в прессе, что у людей вырабатываются нейтрализующие антитела на вакцинные антигены [9, 10]. Однако в связи с такими несовпадениями, хотелось бы получить информацию от разработчиков вакцины «ЭпиВакКорона» о том, как часто на пептиды, используемые в этой вакцине, образуются антитела у людей, и была ли (и как) продемонстрирована защитная функция этих антител? У какого процента людей каждый конкретный пептид из вакцины «Вектора» вызывает производство не просто антител, а именно нейтрализующих антител?

Поиск иммуногенных пептидов для вакцины с использованием кроликов

Можно предположить, что в начале создания «ЭпиВакКороны» у разработчиков было множество пептидов-кандидатов, идентифицированных методом биоинформатического анализа. Как выбрать из них те, что смогли бы обучить B-клетки человека производить антитела, способные узнавать вирусный белок?

Как я уже писала, многие исследователи используют для решения этой проблемы метод пептидного картирования, результаты которого описаны в предыдущем разделе. Разработчики «ЭпиВакКороны» воспользовались другим подходом: иммуногенность пептидов оценивалась с помощью измерения уровня антител, который провоцировал каждый тестируемый пептид после введения кроликам. Этот подход схематично изображен на рис. 3.

Рис. 3. Скрининг пептидов у кроликов
Рис. 3. Скрининг пептидов у кроликов

В данной системе в качестве белка-носителя использовался гемоцианин, который отличается от нуклео­капсидного белка вируса, позднее вошедшего в конечную композицию «ЭпиВакКороны». Проблема этого метода в том, что даже самые иммуногенные для кроликов пептиды могут оказаться совершенно неиммунногенными для человека.

Эволюционная консервативность пептидов «ЭпиВакКороны» и линейных иммуногенных B-клеточных эпитопов известных из литературы

Стоит отметить, что пептиды, выбранные для «ЭпиВакКороны», как заметили разработчики этой вакцины [10] консервативны в эволюции. Они почти или полностью идентичны пептидам из шиповидного белка коронавирусов, выделенных из панголина и летучей мыши.

В нижеприведенной таблице показаны последовательности пептидов, вошедшие в состав вакцины и фрагменты белка, которые содержат экспериментально подтвержденные В-клеточные эпитопы, показанные ранее на рис. 2.  Второй и третий пептид «ЭпиВакКороны» перекрываются, поэтому в таблице они представлены одной последовательностью.

На основании анализа консервативности, сделанного программой BLASTp можно предположить, что при дальнейшей эволюции шиповидного белка в вирусе SARS-CoV-2 аминокислоты в соответствующих пептидах меняться не будут. Если бы на эти пептиды могли бы вырабатываться нейтрализующие антитела, то это могло бы стать большим преимуществом этой пептидной вакцины по сравнению с вакцинами, основанными на полноразмерном шиповидном белке. Мы уже знаем, что мутации в этом белке у вируса могут делать его менее уязвимым к вакцинам.

Дело в том, что, как справедливо замечают разработчики «ЭпиВакКороны» [10], при вакцинации полноразмерным белком, происходит выработка антител на иммунодоминантные эпитопы белка, которые больше всего подвержены антигенному дрейфу.

Тут стоит пояснить термины: «иммунодоминантные эпитопы» в данном контексте, это трехмерные или линейные структуры белков патогенов, на которые у большинства людей вырабатываются антитела. «Антигенный дрейф» — это направленная эволюция белков патогенов, вернее их антитгенных детерминант, которая позволяет патогенам ускользать от иммунного ответа хозяина. Мы уже знаем, что подобный дрейф происходит в настоящее время, и мутации в  некоторых иммунодоминантных эпитопах шиповидного белка SARS-CoV-2 делают вирус менее уязвимым к вакцинации.

Таблица 1. Результаты анализа по выявлению сходства между фрагментами шиповидного белка SARS-CoV-2 с белками коронавирусов животных
Последовательности пептидов Выравнивание пептидов «ЭпиВакКороны» Животное
Пептид 1.

RLFRKSNLKPFERDISTEIYQAGS

RLFRKSNLKPFERDISTEIYQAGS

RLFRKANLKPFERDISTEIYQAGS

летучая мышь
последовательности идентичны панголин
Пептид 2 и 3.

KEIDRLNEVAKNLNESLIDLQELGKYEQYI

последовательности идентичны летучая мышь
панголин
Координаты фрагмента в последовательности

UniProtKBP0DTC2

Выравнивание эспериментально выявленных

вирусных В-клеточных эпитопов

 
487-498 NCYFPLQSYGFQ

NCYFPLQSYGFH

панголин
524-543 последовательность идентична летучая мышь
VCGPKKSTNLVKNKCVNFNF

VCGPKQSTNLVKNKCVNFNF

панголин
551-612 Последовательность идентична летучая мышь
VLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAV

VLTESSKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAV

панголин
625-684 последовательность идентична летучая мышь
HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNS

HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNTYECDIPIGAGICASYQTQTNS

панголин
764-829 Последовательность идентична летучая мышь
NRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLF…

NRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFLQILPDPSKPSKRSFIEDLLF..

панголин
884-895 последовательности идентичны летучая мышь
панголин
1146-1165 последовательности идентичны

 

летучая мышь
панголин
Human

SARS-CoV

1236-1273 последовательности идентичны летучая мышь
панголин

Однако у нас нет данных, демонстрирующих, что три пептида «ЭпиВакКороны» провоцируют образование нейтрализующих антител, поэтому их ценность для вакцины сомнительна. В тоже время, анализ эволюционной консервативности экспериментально подтвержденных линейных В-клеточных эпитопов, результаты которого приведены в таблице 1, показывает, что аминокислотные последовательности этих эпитопов тоже очень консервативны и по консервативности не уступают пептидам «ЭпиВакКороны».

Испытания протективности вакцины на хомяках

Патент [2] сообщает что пять опытных хомяков были вакцинированы и затем заражены вирусом одновременно с контрольными (не получившими вакцину). После этого каждые два дня в смывах носа хомяков из обеих групп проверялась вирусная нагрузка: для этого измерялось число циклов ПЦР до момента появления сигнала в виде визуализации генетического материала вируса (порог Ct).

Что такое пороговое значение Ct?

Метод ПЦР позволяет не только определять присутствие нуклеотидной последовательности (вирусного генетического материала) в образце, но и измерять ее количество. Специальные флуоресцентные красители реагируют с нуклеиновами кислотами и вызывают флуоресценцию. Величина сигнала флуоресценции пропорциональна количеству нуклеиновой кислоты в пробе в момент определенного цикла ПЦР. Иными словами, яркость флуоресцентного сигнала, испускаемого во время циклов амплификации нуклеиновыми кислотами с красителем, растет по мере роста совершенных прибором циклов ПЦР. Номер цикла, при котором прибор только начинает регистрировать флуоресценцию, называется пороговым и обозначается как Ct. То есть это значение — номер цикла, при котором прибор начинает отличать сигнал от фонового значения. Если в образце много вирусного генетического материала, то этот номер цикла будет маленьким (небольшое Ct), поскольку нужно будет произвести мало циклов амплификации для выявления флуоресцентного сигнала. Если в образце мало генетического материала, то флуоресцентный сигнал появится только после многих циклов и Ct будет большим.

По мере выздоровления животных и, соответственно, уменьшения вирусной концентрации в пробах их биологического материала (смывах носа) нужно производить больше циклов ПЦР для достижения регистрации флуоресцентного сигнала прибором — т. е. величина Сt растет. На рис. 4 представлена зависимость средних значений Ct по группе животных с доверительным интервалом от дней после заражения.

Рис. 4. Изучение протективности «ЭпиВакКороны» на хомяках
Рис. 4. Изучение протективности «ЭпиВакКороны» на хомяках

Эксперимент показал, что по критерию вирусной нагрузки в смывах носа опытная и контрольная группы хомяков не различались. Тренды увеличения циклов Сt, необходимых для выявления вирусного генетического материала, по мере увеличения дней после заражения в обеих группах одинаковые. Однако авторы патента сообщают, что разница между двумя группами животных наблюдалась по другому критерию, а именно по соотношению массы легких и общей массы тела. Этот критерий показывает, что отек легких, вызванный инфекцией, у вакцинированных хомяков был меньше по сравнению с контрольными.

Испытания протективности вакцины на хорьках

Патент [2] сообщает, что наряду с хомяками были вакцинированы хорьки, зараженные затем вирусом одновременно с контрольными (невакцинированными) хорьками. После вирусного заражения каждые два дня, по аналогии с хомяками, в смывах носа хорьков из обеих групп проверялась вирусная нагрузка методом ПЦР с определением порога Ct. Результаты эксперимента в сравнении с описанным выше (эксперимент с хомяками) представлены на рис. 5.

Рис. 5. Сравнение протективности вакцины в опытах с хомяками и хорьками
Рис. 5. Сравнение протективности вакцины в опытах с хомяками и хорьками

Оказалось, что вирусная нагрузка драматически падает, в зависимости от времени именно в группе вакцинированных хорьков. Почти все они на восьмой день после заражения выздоровели. Вирус у этих животных в смывах носа не детектировался даже после 40 циклов ПЦР (лишь у одного хорька на восьмой день после заражения его все-таки обнаружили), поэтому среднее значение Сt в этой группе животных условно представлено на графике как 40 — просто потому, что выше 40 значения Сt смысла не имеют. Принято считать, что если вирус не детектировался при проведении 40 циклов ПЦР, значит его в образце нет.

График показывает средние значения Ct в группах как для хомяков, так и для хорьков. Казалось бы, к чему тут можно придраться? Протективная способность вакцины для хорьков налицо! Однако при внимательном рассмотрении графика можно заметить, что на второй день после заражения вирусная нагрузка у хорьков в среднем была значительно меньше, чем у хомяков (средняя величина Сt для хорьков гораздо больше). Различающиеся значения на графике (рис. 5) отмечены голубыми стрелками и вопросительным знаком. Разница по Сt на второй день после заражения между группами хорьков и хомяков составляет около 10 циклов ПЦР или чуть больше.

Поскольку каждый цикл ПЦР примерно удваивает генетический материал вируса в тестируемой пробирке, то такая разница в значениях Сt означает, что у хорьков на второй день после заражения в смывах носа было меньше вируса примерно в 210 (т. е. примерно в 1000) раза по сравнению с хомяками. При этом разработчики пишут, что хорьки получили инфекционный материал вируса, в котором, наоборот, доза инфекционных частиц была в 10 раз больше. Конечно, хорьки гораздо крупнее хомяков и привнесенный в область носа вирусный материал мог распространиться в нижние дыхательные пути в большей степени, чем у хомяков, однако разница в три десятичных порядка все равно выглядит странной.

Выводы и вопросы

Сопоставление пептидов «ЭпиВакКороны» — которые, согласно разработчикам, должны быть B-клеточными эпитопами, распознаваемыми иммунной системой человека, — с пептидами B-клеточных эпитопов, выявленными экспериментально, показывает, что и те и другие эволюционно консервативны.

При этом из-за непрозрачности экспериментов «Вектора», в которые были вовлечены добровольцы, способность пептидов «Вектора» инициировать иммунный ответ у людей вызывает много вопросов. У какого процента добровольцев, участников первой и второй фаз испытаний, возникают нейтрализующие антитела к каждому конкретному пептиду или хотя бы к одному из набора «ЭпиВакКороны»? Все ли пептиды из трех способны провоцировать выработку нейтрализующих антител? Нет ли среди трех пептидов, выбранных для производства вакцины, балласта, не работающего ни у одного человека?

Чтобы ответить на эти вопросы, достаточно, как в описанных выше опытах, иммобилизовать соответствующие пептиды на подложку и изучить комплексообразование между этими пептидами и антителами из сывороток вакцинированных. Технически возможно и оценить нейтрализующий потенциал антител к этим пептидам.

Эксперименты по изучению протективной активности «ЭпиВакКороны», описанные в патенте, свидетельствуют о том, что вакцина защищала животных и способствовала более легкому течению болезни у хомяков и ускоренному выздоровлению у хорьков. Однако эти эксперименты тоже рождают много вопросов, например: появлялись ли у вакцинированных животных нейтрализующие антитела к вирусу, и если да, то каков был титр этих антител; вырабатывался ли у животных Т-клеточный к вирусным антигенам вакцины; пробовали ли разработчики «ЭпиВакКороны» исследовать протективное действие вакцины при заражении животных вирусными нагрузками большими, чем те, что описаны в патенте?

Последний вопрос особенно актуален, поскольку из научных публикаций известно, что хомяки и хорьки хотя и заражаются вирусом SARS-CoV-2, но переносят инфекцию сравнительно легко и выздоравливают без лечения. Поэтому исследователи для изучения действенности лекарственных противовирусных препаратов или протективных свойств антиковидных вакцин [11, 12] часто используют при работе с хомяками и хорьками на порядки более высокие вирусные нагрузки SARS-CoV-2 по сравнению с использованными в экспериментах из патента [2].

Остается надеяться, что научная публикация, которую, как сообщается [4], готовят разработчики «ЭпиВакКороны», будет содержать ответы на эти и подобные вопросы. Зная защитные свойства и механизм протективности вакцины у животных, можно оценить эти свойства вакцины и механизм защиты у людей.

P. S. После поступления этой статьи в печать появилась публикация разработчиков «ЭпиВакКороны» в журнале «Инфекция и иммунитет» о первых фазах клинических испытаний этой вакцины.

Автор выражает признательность канд. биол. наук Елене Кудрявцевой за конструктивные предложения, касающиеся графического оформления статьи; докт. биол. наук Михаилу Гельфанду за научное редактирование. 

Ольга Матвеева,
молекулярный биолог

  1. Матвеева О. В. «ЭпиВакКорона»: что мы знаем и чего не знаем. ТрВ-Наука. № 322 от 9 февраля 2021 года. С. 2–3.
  2. Рыжиков А. Б. и др. Патент RU2 743 593 C1. Пептидные иммуногены и вакцинная композиция против коронавирусной инфекции COVID-19 с использованием пептидных иммуногенов. Опубликовано 20 февраля 2021 года.
  3. ТОП-20 вопросов о вакцине ФБУН ГНЦ ВБ «Вектор» // . 27 января 2021 года.
  4. Протокол встречи РПН, «Вектора» и представителей группы (epivakorona.com).
  5. Zhigang Yi et al. Functional mapping of B-cell linear epitopes of SARS-CoV-2 in COVID-19 convalescent population // Emerging Microbes and Infections. 2020. P. 1988–1996.
  6. Chek M. P. et al. Two linear epitopes on the SARS-CoV-2 spike protein that elicit neutralizing antibodies in COVID-19 patients // Nat. Commun. 2020. 11.
  7. Yang Li et al. Linear epitopes of SARS-CoV-2 spike protein elicit neutralizing antibodies in COVID-19 patients // Cell Mol. Immunol. 2020. P. 1–3.
  8. Farrera-Soler L. Identification of immunodominant linear epitopes from SARS-CoV-2 patient plasma // PLOS One. 2020. 15(9): e0238089.
  9. Что ждать от «ЭпиВакКороны». Все о пептидной вакцине против COVID-19 // РИА Новости. 22 января 2021 года.
  10. В «Векторе» назвали главную ошибку людей, которые боятся заразиться коронавирусом //Накануне.ру. 1 марта 2021 года.
  11. Jasper Fuk-Woo Chan et al. Simulation of the Clinical and Pathological Manifestations of Coronavirus Disease 2019 (COVID-19) in a Golden Syrian Hamster Model: Implications for Disease Pathogenesis and Transmissibility // Clinical Infectious Diseases. 2020. V. 71. P. 2428–2446.
  12. Dose-dependent response to infection with SARS-CoV-2 in the ferret model and evidence of protective immunity // Nat. Commun. 2021, Jan. 4. 12(1). P. 81. DOI: 10.1038/s41467–020–20439-y.

Если вы нашли ошибку, пожалуйста, выделите фрагмент текста и нажмите Ctrl+Enter.

См. также:

Подписаться
Уведомление о
guest
17 Комментария(-ев)
Встроенные отзывы
Посмотреть все комментарии
Пал Палыч
Пал Палыч
8 месяцев(-а) назад

появилась публикация разработчиков «ЭпиВакКороны» в журнале «Инфекция и иммунитет»

нет, они издеваются.
86 «подопытных», 43 вакцина, 43 плацебо.
все торчали 23 дня в госпитале (!) никуда не выходя
в каждой группе по одному заражённому (!)
заражённый в группе плацебо — вмер (deseased). какой у него был возраст — тайна
в группе вакцины — легко отделался, но ему 25 лет.

вывод — эпивак можно спокойно выбрасывать на помойку.

res
res
8 месяцев(-а) назад
В ответ на:  Пал Палыч

Вывод ИМХО излишне категоричен. Статистика никакая, стало быть и выводов нет ))

Пал Палыч
Пал Палыч
8 месяцев(-а) назад
В ответ на:  res

дык
была бы вакцина, статистику раструбили бы по всему миру
эрго
никакой статистики = никакой вакцины

Евгений
Евгений
8 месяцев(-а) назад
В ответ на:  Пал Палыч

Пал Палыч. Сравнивать нужно сравнимое. Сравнивать несравнимое — не нужно.

Опубликованы, наконец-то, результаты РКИ Фазы I-II. Количество участников и условия проведения вполне соответствуют данной фазе РКИ.
А Вы, похоже, сравниваете с РКИ Фазы III, где размеры групп тысячами исчисляются.

Пал Палыч
Пал Палыч
8 месяцев(-а) назад
В ответ на:  Евгений

пока ничего об этой эпиваке неясно
антитела только они сами умеют определять
хотя уже людей давно колют
нет данных — нет вакцины

eugen
eugen
8 месяцев(-а) назад
В ответ на:  Пал Палыч

«нет данных — нет вакцины» строго говоря это можно сказать о всех вакцинах , которые применяют сейчас, т.к. кроме объема выборки при испытаниях медицинских препаратов, существует еще проблема выявления отдаленных эффектов. Это одна из причин почему цикл создания лекарства занимает 10-15 лет. Современные методы биоинформатики позволяют спроектировать нужные антитела (АВ) за пару дней, но дальше надо смотреть на работу таких АВ: в бесклеточной системе , на клеточных культурах, экспериментальных животных, добровольцах в госпиталях и больших контингентах пациентов которых лечат в рамках благотворительности. В ситуации с Covid-19 все спешат, все под давлением и IMHO: единственно, что можно обсуждать серьезно это концепции вакцин, а в таком случае концепция адьюванта синтетических пептидов соответствующих консервативным эпитопам белков вируса, представляется наиболее осторожной с точки зрения отдаленных последствий.

Евгений
Евгений
8 месяцев(-а) назад
В ответ на:  Пал Палыч

Видел это статью.
Там не ясно, эти 18 прививались в рамках вакцинации или в рамках испытаний фазы III?

На всякий случай напомню, что испытания СпутникV стали воспринимать всерьез и печатать в ланцетах, после того как заболело более 70 участников испытаний. И далеко не все из них были в группе «плацебо».

Евгений
Евгений
8 месяцев(-а) назад
В ответ на:  Пал Палыч

На всякий случай, дабы не было недопонимания.

Не утверждаю, что ЭпиВакКорона — прекрасная вакцина, отлично себя зарекомендовавшая. Оснований для этого нет.
Есть основания для сомнений.
А вот оснований, для категорических отрицательных выводов — опять нет.

В.П.
В.П.
8 месяцев(-а) назад
В ответ на:  Евгений

Бремя доказательства лежит на том, кто утверждает нечто новое. Создатели вакцины (либо какая-то проверяющая и регистрирующая инстанция) должны представить убедительные доказательства эффективности вакцины. Пока не доказано обратное, для любого препарата по умолчанию «вывод отрицательный», хотя и не категорический, т.е. нужно дальше испытывать.

Евгений
Евгений
8 месяцев(-а) назад
В ответ на:  В.П.

с этим никто не спорит, надеюсь.

Пал Палыч
Пал Палыч
8 месяцев(-а) назад
В ответ на:  Евгений

Мне коллега и доктор наук, которая работает на Векторе 30 лет на вопрос об ЭпиВакКороне ответила следующее:»Темный лес-кривые сосны». Вот так некоторые доктора наук и вирусологи оценивают разработку Вектора. даже если сами там работают.

из народных мудростей

Евгений
Евгений
8 месяцев(-а) назад
В ответ на:  Пал Палыч

А тут двоемыслие по Оруэллу.
С одной стороны мы будет требовать четких научных доказательств,
а с другой стороны мы будем ссылаться на поговорки, приведенные анонимными знакомыми.

Евгений
Евгений
8 месяцев(-а) назад

Ольга, в очередной раз спасибо за взвешенный разбор.

Дмитр
Дмитр
8 месяцев(-а) назад

От насморка колоться, серьезно!?
Где статистика, где исследования?
Вопросов больше!..
Второй год лохотрона!

trackback

[…] в оппозиционном научном издании Троицкий вариант – https://trv-science.ru/2021/03/epivakkorona-v-illyustraciyax/Заместителем главного редактора, который принимал […]

Леонид Коганов
Леонид Коганов
7 месяцев(-а) назад

Имхо, банальный политдонос (старого протухшего образца), ср. со стр., посвященной раннему выступлению физика и правозащитника Ю.Ф. Орлова.
Л.К.

Оценить: 
Звёзд: 1Звёзд: 2Звёзд: 3Звёзд: 4Звёзд: 5 (5 оценок, среднее: 4,80 из 5)
Загрузка...
 
 

Сообщить об опечатке

Текст, который будет отправлен нашим редакторам: